PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT28631
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 204aa    MW: 22455.4 Da    PI: 9.9786
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT28631genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.66.8e-09671031147
                      HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      l++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
         EMT28631  67 LFLLGLKKYGKGDWRNISRNFVQTRTPTQVASHAQKY 103
                      788899******************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.3E-1066108IPR009057Homeodomain-like
CDDcd001671.03E-666104No hitNo description
TIGRFAMsTIGR015571.5E-1066106IPR006447Myb domain, plants
PfamPF002492.4E-667103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-667102IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MSYSRKHSAP SFFLQICLIL FAPRGGDRSC YHQRNPELLR CRLNPASCHN LSTSLELKLG  60
DSFSCRLFLL GLKKYGKGDW RNISRNFVQT RTPTQVASHA QKYFIRLSSG GGKDKRRSSI  120
HDITTVHLDD QPPSPSQSSM ITQSSAPAPS ATTGQFSLPA DTKQHGGANA PYNSPPSYGM  180
GLQDQGLQCG PLHDQLAANR SMLY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568449.12e-75PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H72e-34DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM8CXT91e-150M8CXT9_AEGTA; Uncharacterized protein
STRINGMLOC_20277.14e-91(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78863348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.12e-16Homeodomain-like transcriptional regulator